Price $50,000 $75,000 $100,000 $150,000 $200,000 $250,000 $300,000 $400,000 $500,000 $600,000 $700,000 $800,000 $900,000 $1,000,000 $1,250,000 $1,500,000 $2,000,000 $3,000,000 $4,000,000 $5,000,000 $6,000,000 $7,000,000 $8,000,000 $9,000,000 $10,000,000 $15,000,000 $20,000,000 $50,000 $75,000 $100,000 $150,000 $200,000 $250,000 $300,000 $400,000 $500,000 $600,000 $700,000 $800,000 $900,000 $1,000,000 $1,250,000 $1,500,000 $2,000,000 $3,000,000 $4,000,000 $5,000,000 $6,000,000 $7,000,000 $8,000,000 $9,000,000 $10,000,000 $15,000,000 $20,000,000
PROP_ADDRESS
PROP_CITY, PROP_STATE
PROP_BEDS / PROP_BATHS
PROP_ACRES
PROP_PRICE
Details
Under Construction. Experience modern sophistication in this exceptional new construction two-story home, perfectly situated …view the listing
The data relating to real estate for sale on this site comes from the Internet Data Exchange (IDX) Program of Stellar MLS. All listing information is deemed reliable but not guaranteed and should be independently verified through personal inspection by appropriate professionals. Listings displayed on this website may be subject to prior sale or removal from sale; the availability of any listing should always be independently verified. Listing information is provided for consumers’ personal, non-commercial use, solely to identify potential properties for potential purchase; all other use is strictly prohibited and may violate relevant federal and state law. This site was last updated Aug-12-2025 8:49:39 pm .
rover-init.php upgrade_options 956: rover-init.php upgrade_options 1034: [roveridx_css_default] is currently [16237] bytes rover-init.php init_front 251: Starting… [php version 7.4.33] rover-init.php init_front 252: REQUEST_URI [/fl/tampa/hiawatha-highlands-rev-map] rover-init.php init_front 253: parsed REQUEST_URI [/fl/tampa/hiawatha-highlands-rev-map] rover-init.php init_front 254: the_page_clean [fltampahiawathahighlandsrevmap] rover-init.php check_url_for_idx_keys 812: url [/fl/tampa/hiawatha-highlands-rev-map] rover-init.php match_slug 861: Comparing fl to FL rover-init.php match_slug 868: Found slug (FL) rover-init.php match_slug 861: Comparing fl to PR rover-init.php match_slug 861: Comparing fl to Florida rover-init.php match_slug 861: Comparing fl to Puerto Rico rover-init.php init_front 308: WordPress 6.0.0 detected, skipping do_parse_request rover-init.php init_front 322: path [/fl/tampa/hiawatha-highlands-rev-map] does not exist in WP rover-init.php rewrite_rules 163: add_rewrite_rules rover-init.php rewrite_rules 182: add_rewrite_rules: adding [fl,pr,florida,puerto rico] rover-content.php dynamic_page_template_redirect 37: Starting rover-content.php get_api_key 384: starting rover-content.php get_api_key 422: Returning [617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc] rover-content.php translate_component 689: [ROVER_COMPONENT_404] rover-content.php translate_component 695: Comparing [FL] with [agent-detail] rover-content.php cookies 1019: is rover-content.php rover_content 785: region => MFRMLS rover-content.php rover_content 785: component => ROVER_COMPONENT_404 rover-content.php rover_content 785: is_wp => 1 rover-content.php rover_content 785: signature => 67d14e7729d3a8446ebf5e5e97f684db rover-content.php rover_content 785: cookies => rover-content.php rover_content 785: domain_id => 2006 rover-content.php rover_content 785: domain => https://hasenbeckhomes.com rover-content.php rover_content 785: page => 1 rover-content.php rover_content 785: api_key => 617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc rover-content.php rover_content 785: user_agent => Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) rover-content.php rover_content 785: user_ip => 216.73.216.119 rover-content.php rover_content 785: server_ip => 66.29.146.37 rover-content.php rover_content 785: path_url => /fl/tampa/hiawatha-highlands-rev-map rover-content.php rover_content 785: query_url => rover-content.php rover_content 785: is_amp => rover-content.php rover_content 785: force_crawler => 0 rover-content.php rover_content 785: wp_permalinks => /%postname%/ rover-content.php rover_content 785: version_php => 7.4.33 rover-content.php rover_content 785: version_wp => 6.8.2 rover-content.php rover_content 805: https://ep3.roveridx.com/3.0.0/php/request.php rover-content.php rover_content 806: region=MFRMLS&component=ROVER_COMPONENT_404&is_wp=1&signature=67d14e7729d3a8446ebf5e5e97f684db&cookies=&domain_id=2006&domain=https%3A%2F%2Fhasenbeckhomes.com&page=1&api_key=617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc&user_agent=Mozilla%2F5.0+AppleWebKit%2F537.36+%28KHTML%2C+like+Gecko%3B+compatible%3B+ClaudeBot%2F1.0%3B+%2Bclaudebot%40anthropic.com%29&user_ip=216.73.216.119&server_ip=66.29.146.37&path_url=%2Ffl%2Ftampa%2Fhiawatha-highlands-rev-map&query_url=&is_amp=0&force_crawler=0&wp_permalinks=%2F%25postname%25%2F&version_php=7.4.33&version_wp=6.8.2 rover-content.php rover_content 887: curl took [0.84665] seconds rover-content.php dump_curl_timers 978: curl_timer summary ******** rover-content.php dump_curl_timers 988: curl_timers [namelookup_time_us ] => [2.5E-5 ] seconds rover-content.php dump_curl_timers 988: curl_timers [connect_time_us ] => [0.064963] seconds rover-content.php dump_curl_timers 988: curl_timers [appconnect_time_us ] => [0.201113] seconds rover-content.php dump_curl_timers 988: curl_timers [pretransfer_time_us ] => [0.201329] seconds rover-content.php dump_curl_timers 988: curl_timers [redirect_time_us ] => [0 ] seconds rover-content.php dump_curl_timers 988: curl_timers [starttransfer_time_us ] => [0.843704] seconds rover-content.php dump_curl_timers 994: curl_timers [total_time_us ] => [0.844736] seconds rover-content.php dump_curl_timers 995: curl_timers [*_time_us adds up to ] => [1.311134] seconds rover-content.php dump_curl_timers 996: curl_timers [unaccounted for ] => [-0.466398] seconds rover-content.php rover_content 936: the_html is 122307 bytes rover-content.php rover_content 937: the_og_images are 139 bytes rover-content.php check_js_version 438: latest_js_ver [1801776] / [1801776] rover-content.php init_404_content 74: rover_component is [ROVER_COMPONENT_404] rover-content.php init_404_content 75: 122307 bytes received from rover_content rover-content.php init_404_content 76: redirect is [] rover-content.php init_404_content 90: *** This is a Dynamic Page *** rover-content.php generate_404_content 196: Creating content for MFRMLS (122307 bytes) [https://hasenbeckhomes.com/fl/tampa/hiawatha-highlands-rev-map]