Condo
Land
Single Family
Search listings using this Saved Search.
Get email when new and updated listings match this saved search.
Get email when newly sold listings match this saved search.
Save Search
Delete Shape
Click on these drawing tools to draw shapes to contain listings. You can save these shapes as a Saved Search.
120 W HIAWATHA STREET
Discover the exquisite charm of this 1920s Craftsman-style bungalow nestled in the sun-drenched neighborhood of Seminole Heig…
view the listing
The data relating to real estate for sale on this site comes from the Broker Reciprocity (BR) of the Stellar MLS. All properties are subject to prior sale, changes, or withdrawal.
This site was last updated Nov-22-2024 9:33:00 am.
This site was last updated Nov-22-2024 9:33:00 am.
LIGHTBOX-IMAGES
rover-init.php upgrade_options 955:
rover-init.php upgrade_options 1033: [roveridx_css_default] is currently [16237] bytes
rover-init.php init_front 250: Starting… [php version 7.4.33]
rover-init.php init_front 251: REQUEST_URI [/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php init_front 252: parsed REQUEST_URI [/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php init_front 253: the_page_clean [fltampahiawathahighlandsrevmap]
rover-init.php check_url_for_idx_keys 811: url [/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php match_slug 860: Comparing fl to FL
rover-init.php match_slug 867: Found slug (FL)
rover-init.php match_slug 860: Comparing fl to PR
rover-init.php match_slug 860: Comparing fl to Florida
rover-init.php match_slug 860: Comparing fl to Puerto Rico
rover-init.php init_front 307: WordPress 6.0.0 detected, skipping do_parse_request
rover-init.php init_front 321: path [/fl/tampa/hiawatha-highlands-rev-map] does not exist in WP
rover-init.php rewrite_rules 162: add_rewrite_rules
rover-init.php rewrite_rules 181: add_rewrite_rules: adding [fl,pr,florida,puerto rico]
rover-content.php dynamic_page_template_redirect 37: Starting
rover-content.php get_api_key 384: starting
rover-content.php get_api_key 422: Returning [617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc]
rover-content.php translate_component 689: [ROVER_COMPONENT_404]
rover-content.php translate_component 695: Comparing [FL] with [agent-detail]
rover-content.php cookies 1019: is
rover-content.php rover_content 785: region => MFRMLS
rover-content.php rover_content 785: component => ROVER_COMPONENT_404
rover-content.php rover_content 785: is_wp => 1
rover-content.php rover_content 785: signature => 67d14e7729d3a8446ebf5e5e97f684db
rover-content.php rover_content 785: cookies =>
rover-content.php rover_content 785: domain_id => 2006
rover-content.php rover_content 785: domain => https://hasenbeckhomes.com
rover-content.php rover_content 785: page => 1
rover-content.php rover_content 785: api_key => 617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc
rover-content.php rover_content 785: user_agent => Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)
rover-content.php rover_content 785: user_ip => 3.144.20.66
rover-content.php rover_content 785: server_ip => 66.29.146.37
rover-content.php rover_content 785: path_url => /fl/tampa/hiawatha-highlands-rev-map
rover-content.php rover_content 785: query_url =>
rover-content.php rover_content 785: is_amp =>
rover-content.php rover_content 785: force_crawler => 0
rover-content.php rover_content 785: wp_permalinks => /%postname%/
rover-content.php rover_content 785: version_php => 7.4.33
rover-content.php rover_content 785: version_wp => 6.7.1
rover-content.php rover_content 805: https://ep3.roveridx.com/3.0.0/php/request.php
rover-content.php rover_content 806: region=MFRMLS&component=ROVER_COMPONENT_404&is_wp=1&signature=67d14e7729d3a8446ebf5e5e97f684db&cookies=&domain_id=2006&domain=https%3A%2F%2Fhasenbeckhomes.com&page=1&api_key=617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc&user_agent=Mozilla%2F5.0+AppleWebKit%2F537.36+%28KHTML%2C+like+Gecko%3B+compatible%3B+ClaudeBot%2F1.0%3B+%2Bclaudebot%40anthropic.com%29&user_ip=3.144.20.66&server_ip=66.29.146.37&path_url=%2Ffl%2Ftampa%2Fhiawatha-highlands-rev-map&query_url=&is_amp=0&force_crawler=0&wp_permalinks=%2F%25postname%25%2F&version_php=7.4.33&version_wp=6.7.1
rover-content.php rover_content 887: curl took [0.87322] seconds
rover-content.php dump_curl_timers 978: curl_timer summary ********
rover-content.php dump_curl_timers 988: curl_timers [namelookup_time_us ] => [5.6E-5 ] seconds
rover-content.php dump_curl_timers 988: curl_timers [connect_time_us ] => [0.068546] seconds
rover-content.php dump_curl_timers 988: curl_timers [appconnect_time_us ] => [0.210351] seconds
rover-content.php dump_curl_timers 988: curl_timers [pretransfer_time_us ] => [0.2108 ] seconds
rover-content.php dump_curl_timers 988: curl_timers [redirect_time_us ] => [0 ] seconds
rover-content.php dump_curl_timers 988: curl_timers [starttransfer_time_us ] => [0.867467] seconds
rover-content.php dump_curl_timers 994: curl_timers [total_time_us ] => [0.869777] seconds
rover-content.php dump_curl_timers 995: curl_timers [*_time_us adds up to ] => [1.35722 ] seconds
rover-content.php dump_curl_timers 996: curl_timers [unaccounted for ] => [-0.487443] seconds
rover-content.php rover_content 936: the_html is 120171 bytes
rover-content.php rover_content 937: the_og_images are 139 bytes
rover-content.php check_js_version 438: latest_js_ver [1801759] / [1801759]
rover-content.php init_404_content 74: rover_component is [ROVER_COMPONENT_404]
rover-content.php init_404_content 75: 120171 bytes received from rover_content
rover-content.php init_404_content 76: redirect is []
rover-content.php init_404_content 90: *** This is a Dynamic Page ***
rover-content.php generate_404_content 196: Creating content for MFRMLS (120171 bytes) [https://hasenbeckhomes.com/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php upgrade_options 1033: [roveridx_css_default] is currently [16237] bytes
rover-init.php init_front 250: Starting… [php version 7.4.33]
rover-init.php init_front 251: REQUEST_URI [/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php init_front 252: parsed REQUEST_URI [/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php init_front 253: the_page_clean [fltampahiawathahighlandsrevmap]
rover-init.php check_url_for_idx_keys 811: url [/fl/tampa/hiawatha-highlands-rev-map]
rover-init.php match_slug 860: Comparing fl to FL
rover-init.php match_slug 867: Found slug (FL)
rover-init.php match_slug 860: Comparing fl to PR
rover-init.php match_slug 860: Comparing fl to Florida
rover-init.php match_slug 860: Comparing fl to Puerto Rico
rover-init.php init_front 307: WordPress 6.0.0 detected, skipping do_parse_request
rover-init.php init_front 321: path [/fl/tampa/hiawatha-highlands-rev-map] does not exist in WP
rover-init.php rewrite_rules 162: add_rewrite_rules
rover-init.php rewrite_rules 181: add_rewrite_rules: adding [fl,pr,florida,puerto rico]
rover-content.php dynamic_page_template_redirect 37: Starting
rover-content.php get_api_key 384: starting
rover-content.php get_api_key 422: Returning [617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc]
rover-content.php translate_component 689: [ROVER_COMPONENT_404]
rover-content.php translate_component 695: Comparing [FL] with [agent-detail]
rover-content.php cookies 1019: is
rover-content.php rover_content 785: region => MFRMLS
rover-content.php rover_content 785: component => ROVER_COMPONENT_404
rover-content.php rover_content 785: is_wp => 1
rover-content.php rover_content 785: signature => 67d14e7729d3a8446ebf5e5e97f684db
rover-content.php rover_content 785: cookies =>
rover-content.php rover_content 785: domain_id => 2006
rover-content.php rover_content 785: domain => https://hasenbeckhomes.com
rover-content.php rover_content 785: page => 1
rover-content.php rover_content 785: api_key => 617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc
rover-content.php rover_content 785: user_agent => Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)
rover-content.php rover_content 785: user_ip => 3.144.20.66
rover-content.php rover_content 785: server_ip => 66.29.146.37
rover-content.php rover_content 785: path_url => /fl/tampa/hiawatha-highlands-rev-map
rover-content.php rover_content 785: query_url =>
rover-content.php rover_content 785: is_amp =>
rover-content.php rover_content 785: force_crawler => 0
rover-content.php rover_content 785: wp_permalinks => /%postname%/
rover-content.php rover_content 785: version_php => 7.4.33
rover-content.php rover_content 785: version_wp => 6.7.1
rover-content.php rover_content 805: https://ep3.roveridx.com/3.0.0/php/request.php
rover-content.php rover_content 806: region=MFRMLS&component=ROVER_COMPONENT_404&is_wp=1&signature=67d14e7729d3a8446ebf5e5e97f684db&cookies=&domain_id=2006&domain=https%3A%2F%2Fhasenbeckhomes.com&page=1&api_key=617aff8e2a24c2c563568ec46a8aeca1750ac219e604a2b10c999ca0aa76f2cc&user_agent=Mozilla%2F5.0+AppleWebKit%2F537.36+%28KHTML%2C+like+Gecko%3B+compatible%3B+ClaudeBot%2F1.0%3B+%2Bclaudebot%40anthropic.com%29&user_ip=3.144.20.66&server_ip=66.29.146.37&path_url=%2Ffl%2Ftampa%2Fhiawatha-highlands-rev-map&query_url=&is_amp=0&force_crawler=0&wp_permalinks=%2F%25postname%25%2F&version_php=7.4.33&version_wp=6.7.1
rover-content.php rover_content 887: curl took [0.87322] seconds
rover-content.php dump_curl_timers 978: curl_timer summary ********
rover-content.php dump_curl_timers 988: curl_timers [namelookup_time_us ] => [5.6E-5 ] seconds
rover-content.php dump_curl_timers 988: curl_timers [connect_time_us ] => [0.068546] seconds
rover-content.php dump_curl_timers 988: curl_timers [appconnect_time_us ] => [0.210351] seconds
rover-content.php dump_curl_timers 988: curl_timers [pretransfer_time_us ] => [0.2108 ] seconds
rover-content.php dump_curl_timers 988: curl_timers [redirect_time_us ] => [0 ] seconds
rover-content.php dump_curl_timers 988: curl_timers [starttransfer_time_us ] => [0.867467] seconds
rover-content.php dump_curl_timers 994: curl_timers [total_time_us ] => [0.869777] seconds
rover-content.php dump_curl_timers 995: curl_timers [*_time_us adds up to ] => [1.35722 ] seconds
rover-content.php dump_curl_timers 996: curl_timers [unaccounted for ] => [-0.487443] seconds
rover-content.php rover_content 936: the_html is 120171 bytes
rover-content.php rover_content 937: the_og_images are 139 bytes
rover-content.php check_js_version 438: latest_js_ver [1801759] / [1801759]
rover-content.php init_404_content 74: rover_component is [ROVER_COMPONENT_404]
rover-content.php init_404_content 75: 120171 bytes received from rover_content
rover-content.php init_404_content 76: redirect is []
rover-content.php init_404_content 90: *** This is a Dynamic Page ***
rover-content.php generate_404_content 196: Creating content for MFRMLS (120171 bytes) [https://hasenbeckhomes.com/fl/tampa/hiawatha-highlands-rev-map]